SCOPe 2.08: Domain d1jera_: 1jer A:

Lineage for d1jera_ (1jer A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Stellacyanin [49539] (1 species)

7. Species Cucumber (Cucumis sativus) [TaxId:3659] [49540] (1 PDB entry)

8. Domain d1jera_: 1jer A: [23022]
   CASP2
   complexed with cu

Details for d1jera_

PDB Entry: 1jer, 1.6 Å

PDB Description: cucumber stellacyanin, cu2+, ph 7.0

PDB Compounds: (A:) cucumber stellacyanin

SCOPe Domain Sequences for d1jera_:

Sequence; same for both SEQRES and ATOM records:

>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]}
mqstvhivgdntgwsvpsspnfysqwaagktfrvgdslqfnfpanahnvhemetkqsfda
cnfvnsdndvertspvierldelgmhyfvctvgthcsngqklsinvvaan

Timeline for d1jera_:

• d1jera_ first appeared (with stable ids) in SCOP 1.55, called d1jer__
  
• d1jera_ appears in SCOPe 2.07