Lineage for d3wgjb1 (3wgj B:12-208)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445159Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2445208Species Staphylococcus aureus [TaxId:1280] [226386] (6 PDB entries)
  8. 2445214Domain d3wgjb1: 3wgj B:12-208 [230218]
    Other proteins in same PDB: d3wgja2
    automated match to d4dxda1
    complexed with ca; mutant

Details for d3wgjb1

PDB Entry: 3wgj (more details), 2.18 Å

PDB Description: staphylococcus aureus ftsz t7 chimera mutant, t7bs
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgjb1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliatpglin

SCOPe Domain Coordinates for d3wgjb1:

Click to download the PDB-style file with coordinates for d3wgjb1.
(The format of our PDB-style files is described here.)

Timeline for d3wgjb1: