SCOPe 2.08: Domain d3wgjb1: 3wgj B:12-208

Lineage for d3wgjb1 (3wgj B:12-208)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [226386] (16 PDB entries)

8. Domain d3wgjb1: 3wgj B:12-208 [230218]
   Other proteins in same PDB: d3wgja2
   automated match to d4dxda1
   complexed with ca; mutant

Details for d3wgjb1

PDB Entry: 3wgj, 2.18 Å

PDB Description: staphylococcus aureus ftsz t7 chimera mutant, t7bs

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgjb1:

Sequence; same for both SEQRES and ATOM records:

>d3wgjb1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliatpglin

Timeline for d3wgjb1:

• d3wgjb1 first appeared in SCOPe 2.03
  
• d3wgjb1 appears in SCOPe 2.07