SCOPe 2.08: Domain d3wgja2: 3wgj A:209-315

Lineage for d3wgja2 (3wgj A:209-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Staphylococcus aureus [TaxId:1280] [226387] (4 PDB entries)

8. Domain d3wgja2: 3wgj A:209-315 [230216]
   Other proteins in same PDB: d3wgja1, d3wgjb1
   automated match to d4dxda2
   complexed with ca; mutant
   missing some secondary structures that made up less than one-third of the common domain

Details for d3wgja2

PDB Entry: 3wgj, 2.18 Å

PDB Description: staphylococcus aureus ftsz t7 chimera mutant, t7bs

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d3wgja2:

Sequence; same for both SEQRES and ATOM records:

>d3wgja2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
ldfadvktimsnqgsalmgigvssgenraveaakkaissplletsivgaqgvlmnitgge
slslfeaqeaadivqdaadedvnmifgtvinpelqdeivvtviatgf

Timeline for d3wgja2:

• d3wgja2 first appeared in SCOPe 2.03
  
• d3wgja2 appears in SCOPe 2.07