Lineage for d3wgnb1 (3wgn B:12-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863242Species Staphylococcus aureus [TaxId:158878] [226455] (7 PDB entries)
  8. 2863256Domain d3wgnb1: 3wgn B:12-208 [230212]
    Other proteins in same PDB: d3wgna2, d3wgnb2
    automated match to d3vo8a1
    complexed with gsp

Details for d3wgnb1

PDB Entry: 3wgn (more details), 2.61 Å

PDB Description: staphylococcus aureus ftsz bound with gtp-gamma-s
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wgnb1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d3wgnb1:

Click to download the PDB-style file with coordinates for d3wgnb1.
(The format of our PDB-style files is described here.)

Timeline for d3wgnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wgnb2