SCOPe 2.07: Domain d3wgnb1: 3wgn B:12-208

Lineage for d3wgnb1 (3wgn B:12-208)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Staphylococcus aureus [TaxId:158878] [226455] (7 PDB entries)

8. Domain d3wgnb1: 3wgn B:12-208 [230212]
   Other proteins in same PDB: d3wgna2, d3wgnb2
   automated match to d3vo8a1
   complexed with gsp

Details for d3wgnb1

PDB Entry: 3wgn, 2.61 Å

PDB Description: staphylococcus aureus ftsz bound with gtp-gamma-s

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d3wgnb1:

Sequence; same for both SEQRES and ATOM records:

>d3wgnb1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 158878]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsfegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

Timeline for d3wgnb1:

• d3wgnb1 first appeared in SCOPe 2.03
  
• d3wgnb1 appears in SCOPe 2.06
  
• d3wgnb1 appears in the current release, SCOPe 2.08