Lineage for d4nrca_ (4nrc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1487981Domain d4nrca_: 4nrc A: [230177]
    automated match to d3g0la_
    complexed with 15p, 2ly, edo

Details for d4nrca_

PDB Entry: 4nrc (more details), 1.86 Å

PDB Description: Crystal Structure of the bromodomain of human BAZ2B in complex with compound-3 N01186
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4nrca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nrca_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d4nrca_:

Click to download the PDB-style file with coordinates for d4nrca_.
(The format of our PDB-style files is described here.)

Timeline for d4nrca_: