SCOPe 2.07: Domain d1e30b_: 1e30 B:

Lineage for d1e30b_ (1e30 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Rusticyanin [49537] (1 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [49538] (7 PDB entries)

8. Domain d1e30b_: 1e30 B: [23017]
   complexed with cu; mutant

Details for d1e30b_

PDB Entry: 1e30, 1.5 Å

PDB Description: crystal structure of the met148gln mutant of rusticyanin at 1.5 angstrom resolution

PDB Compounds: (B:) rusticyanin

SCOPe Domain Sequences for d1e30b_:

Sequence; same for both SEQRES and ATOM records:

>d1e30b_ b.6.1.1 (B:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]}
ldttwkeatlpqvkamlekdtgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknp
tleipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgy
tnftwhptagtyyyvcqipghaatgqfgkivvk

Timeline for d1e30b_:

• d1e30b_ first appeared (with stable ids) in SCOP 1.55
  
• d1e30b_ appears in SCOPe 2.06
  
• d1e30b_ appears in the current release, SCOPe 2.08