| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (36 species) not a true protein |
| Species Amphitrite ornata [TaxId:129555] [189339] (3 PDB entries) |
| Domain d4kn3b_: 4kn3 B: [230076] automated match to d4kn3a_ complexed with hem, so4, t6c; mutant |
PDB Entry: 4kn3 (more details), 1.78 Å
SCOPe Domain Sequences for d4kn3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kn3b_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk
Timeline for d4kn3b_: