SCOPe 2.08: Domain d1azua_: 1azu A:

Lineage for d1azua_ (1azu A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d1azua_: 1azu A: [23007]
   complexed with cu

Details for d1azua_

PDB Entry: 1azu, 2.7 Å

PDB Description: structural features of azurin at 2.7 angstroms resolution

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1azua_:

Sequence; same for both SEQRES and ATOM records:

>d1azua_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalmk
gtltlk

Timeline for d1azua_:

• d1azua_ first appeared (with stable ids) in SCOP 1.55, called d1azu__
  
• d1azua_ appears in SCOPe 2.07