PDB entry 1azu

View 1azu on RCSB PDB site
Description: structural features of azurin at 2.7 angstroms resolution
Class: electron transport (copper binding)
Keywords: electron transport (copper binding)
Deposited on 1980-08-04, released 1980-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.35
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1azua_
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1azuA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    mkgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1azuA (A:)
    csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
    gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsalmk
    gtltlk