SCOPe 2.03: Domain d4ijga1: 4ijg A:7-130

Lineage for d4ijga1 (4ijg A:7-130)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (10 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [230052] (1 PDB entry)

8. Domain d4ijga1: 4ijg A:7-130 [230053]
   Other proteins in same PDB: d4ijga2
   automated match to d2o9ba2
   complexed with gol, lbv, peg, po4

Details for d4ijga1

PDB Entry: 4ijg, 1.7 Å

PDB Description: Crystal structure of monomeric bacteriophytochrome

PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d4ijga1:

Sequence; same for both SEQRES and ATOM records:

>d4ijga1 d.110.3.0 (A:7-130) automated matches {Deinococcus radiodurans [TaxId: 243230]}
pffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgqep
tvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellilef
epte

Timeline for d4ijga1:

• d4ijga1 is new in SCOPe 2.03-stable
  
• d4ijga1 appears in SCOPe 2.04
  
• d4ijga1 appears in the current release, SCOPe 2.08