Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) alpha-beta(2)-alpha(2)-beta(3) |
Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
Protein automated matches [190492] (10 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [230052] (1 PDB entry) |
Domain d4ijga1: 4ijg A:7-130 [230053] Other proteins in same PDB: d4ijga2 automated match to d2o9ba2 complexed with gol, lbv, peg, po4 |
PDB Entry: 4ijg (more details), 1.7 Å
SCOPe Domain Sequences for d4ijga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ijga1 d.110.3.0 (A:7-130) automated matches {Deinococcus radiodurans [TaxId: 243230]} pffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgqep tvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellilef epte
Timeline for d4ijga1: