Lineage for d4nvca_ (4nvc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005120Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2005140Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2005141Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2005247Domain d4nvca_: 4nvc A: [229976]
    automated match to d1kxna_
    complexed with ben, hem

Details for d4nvca_

PDB Entry: 4nvc (more details), 1.6 Å

PDB Description: predicting protein conformational response in prospective ligand discovery
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d4nvca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvca_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4nvca_:

Click to download the PDB-style file with coordinates for d4nvca_.
(The format of our PDB-style files is described here.)

Timeline for d4nvca_: