Lineage for d1etjc_ (1etj C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770509Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
    Uniprot P00282
  8. 2770787Domain d1etjc_: 1etj C: [22989]
    complexed with cu; mutant

Details for d1etjc_

PDB Entry: 1etj (more details), 2.3 Å

PDB Description: azurin mutant with met 121 replaced by glu
PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d1etjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etjc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
ekgtltlk

SCOPe Domain Coordinates for d1etjc_:

Click to download the PDB-style file with coordinates for d1etjc_.
(The format of our PDB-style files is described here.)

Timeline for d1etjc_: