| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Azurin [49530] (6 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries) Uniprot P00282 |
| Domain d1etja_: 1etj A: [22987] complexed with cu; mutant |
PDB Entry: 1etj (more details), 2.3 Å
SCOPe Domain Sequences for d1etja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1etja_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
ekgtltlk
Timeline for d1etja_: