Lineage for d4hpxb_ (4hpx B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621089Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1621090Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1621091Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1621260Protein Tryptophan synthase, beta-subunit [53688] (3 species)
  7. 1621272Species Salmonella enterica [TaxId:90371] [229810] (5 PDB entries)
  8. 1621275Domain d4hpxb_: 4hpx B: [229813]
    Other proteins in same PDB: d4hpxa_
    automated match to d1kfjb_
    complexed with 0jo, bcn, bzi, cs, f9f, peg

Details for d4hpxb_

PDB Entry: 4hpx (more details), 1.65 Å

PDB Description: crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4hpxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpxb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

SCOPe Domain Coordinates for d4hpxb_:

Click to download the PDB-style file with coordinates for d4hpxb_.
(The format of our PDB-style files is described here.)

Timeline for d4hpxb_: