Lineage for d4c20a2 (4c20 A:354-588)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402483Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 2402502Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 2402503Protein automated matches [227032] (5 species)
    not a true protein
  7. 2402550Species Streptococcus pneumoniae [TaxId:170187] [229525] (3 PDB entries)
  8. 2402551Domain d4c20a2: 4c20 A:354-588 [229530]
    Other proteins in same PDB: d4c20a1, d4c20b1, d4c20b3
    automated match to d1fuia1
    complexed with edo, mn, so4, trs

Details for d4c20a2

PDB Entry: 4c20 (more details), 2.41 Å

PDB Description: L-Fucose Isomerase
PDB Compounds: (A:) l-fucose isomerase

SCOPe Domain Sequences for d4c20a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c20a2 b.43.2.0 (A:354-588) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
pqifadvrtywspeavkrvtghtlegraaagflhlinsgsctldgtgqatrdgkpimkpf
weleesevqamlentdfppanreyfrgggfstrfltkgdmpvtmvrlnllkgvgpvlqia
egytlelpedvhhtldnrtdpgwpttwfaprltgkgafksvydvmnnwganhgaityghi
gadlitlasmlripvnmhnvpeedifrpknwslfgtedlesadyracqllgplhk

SCOPe Domain Coordinates for d4c20a2:

Click to download the PDB-style file with coordinates for d4c20a2.
(The format of our PDB-style files is described here.)

Timeline for d4c20a2: