Lineage for d4bgib_ (4bgi B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2451247Protein automated matches [190085] (58 species)
    not a true protein
  7. 2451622Species Mycobacterium tuberculosis [TaxId:83332] [229356] (1 PDB entry)
  8. 2451624Domain d4bgib_: 4bgi B: [229502]
    automated match to d4bgia_
    complexed with i4i, nad; mutant

Details for d4bgib_

PDB Entry: 4bgi (more details), 2.09 Å

PDB Description: crystal structure of inha(s94a) mutant in complex with oh-141
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4bgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgib_ c.2.1.2 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
glldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakaplle
ldvqneehlaslagrvteaigagnkldgvvhaigfmpqtgmginpffdapyadvskgihi
saysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagky
gvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvaktv
callsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d4bgib_:

Click to download the PDB-style file with coordinates for d4bgib_.
(The format of our PDB-style files is described here.)

Timeline for d4bgib_: