Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Murinae, homo sapiens [TaxId:39107] [228174] (2 PDB entries) |
Domain d4gw1a1: 4gw1 A:1-107 [229498] Other proteins in same PDB: d4gw1a2, d4gw1c2 automated match to d1g9ml1 complexed with po4 |
PDB Entry: 4gw1 (more details), 2.24 Å
SCOPe Domain Sequences for d4gw1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gw1a1 b.1.1.0 (A:1-107) automated matches {Murinae, homo sapiens [TaxId: 39107]} dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk
Timeline for d4gw1a1: