Lineage for d1e5zc_ (1e5z C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1302648Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1302724Protein Azurin [49530] (6 species)
  7. 1302755Species Pseudomonas aeruginosa [TaxId:287] [49533] (78 PDB entries)
    Uniprot P00282
  8. 1302856Domain d1e5zc_: 1e5z C: [22941]
    complexed with cu, no3

Details for d1e5zc_

PDB Entry: 1e5z (more details), 2 Å

PDB Description: azurin from pseudomonas aeruginosa, reduced form, ph 9.0
PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d1e5zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5zc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d1e5zc_:

Click to download the PDB-style file with coordinates for d1e5zc_.
(The format of our PDB-style files is described here.)

Timeline for d1e5zc_: