Lineage for d1e5zc_ (1e5z C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10946Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 10967Domain d1e5zc_: 1e5z C: [22941]

Details for d1e5zc_

PDB Entry: 1e5z (more details), 2 Å

PDB Description: azurin from pseudomonas aeruginosa, reduced form, ph 9.0

SCOP Domain Sequences for d1e5zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5zc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1e5zc_:

Click to download the PDB-style file with coordinates for d1e5zc_.
(The format of our PDB-style files is described here.)

Timeline for d1e5zc_: