Lineage for d3znkc_ (3znk C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048145Species Influenza virus [TaxId:644788] [193029] (6 PDB entries)
  8. 2048156Domain d3znkc_: 3znk C: [229358]
    Other proteins in same PDB: d3znkb_, d3znkd_, d3znkf_
    automated match to d4bgxa_
    complexed with epe, nag

Details for d3znkc_

PDB Entry: 3znk (more details), 2.71 Å

PDB Description: h5 haemagglutinin in complex with 6-o-sulfo-2,3-sialyllactosamine (sulfated 3'sln)
PDB Compounds: (C:) Haemagglutinin

SCOPe Domain Sequences for d3znkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3znkc_ b.19.1.2 (C:) automated matches {Influenza virus [TaxId: 644788]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d3znkc_:

Click to download the PDB-style file with coordinates for d3znkc_.
(The format of our PDB-style files is described here.)

Timeline for d3znkc_: