SCOPe 2.07: Domain d4m8ua1: 4m8u A:2-482

Lineage for d4m8ua1 (4m8u A:2-482)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228099] (5 PDB entries)

8. Domain d4m8ua1: 4m8u A:2-482 [229319]
   Other proteins in same PDB: d4m8ua2
   automated match to d1uoka2
   complexed with ca, gol, trs; mutant

Details for d4m8ua1

PDB Entry: 4m8u, 1.45 Å

PDB Description: The Structure of MalL mutant enzyme V200A from Bacillus subtilus

PDB Compounds: (A:) Oligo-1,6-glucosidase 1

SCOPe Domain Sequences for d4m8ua1:

Sequence; same for both SEQRES and ATOM records:

>d4m8ua1 c.1.8.1 (A:2-482) automated matches {Bacillus subtilis [TaxId: 224308]}
sewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddng
ydisdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpy
rdyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrev
ydvmrfwmdrgvdgwrmdaigsiskytdfpdyetdhsrsyivgryhsngprlhefiqemn
revlshydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikp
fdlialkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgm
kgtpfiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdha
rtpmqwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimi
y

Timeline for d4m8ua1:

• d4m8ua1 first appeared in SCOPe 2.03
  
• d4m8ua1 appears in SCOPe 2.06
  
• d4m8ua1 appears in the current release, SCOPe 2.08