Lineage for d4kthe1 (4kth E:1-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047863Domain d4kthe1: 4kth E:1-320 [229304]
    Other proteins in same PDB: d4ktha2, d4kthb_, d4kthc2, d4kthd1, d4kthd2, d4kthe2, d4kthf_
    automated match to d1rvxa_
    complexed with nag

Details for d4kthe1

PDB Entry: 4kth (more details), 2.6 Å

PDB Description: structure of a/hubei/1/2010 h5 ha
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4kthe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kthe1 b.19.1.2 (E:1-320) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dhicigyhannsteqvdtimeknvtvthaqdilekthngklcdlngvkplilkdcsvagw
llgnpmcdefinvpewsyivekanpandlcypgnfndyeelkhllsrinhfekiqiipkn
swsdheaslgvsaacpyqgkssffrnvvwlikkdnayptikkgynntnqedllvlwgihh
pndeaeqtrlyqnpttyisigtstlnqrlvpkiatrskingqsgridffwtilkpndaih
fesngnfiapeyaykivkkgdstimkseveygncntrcqtpigainssmpfhnihpltig
ecpkyvksnklvlatglrns

SCOPe Domain Coordinates for d4kthe1:

Click to download the PDB-style file with coordinates for d4kthe1.
(The format of our PDB-style files is described here.)

Timeline for d4kthe1: