Lineage for d4hpgb_ (4hpg B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819412Protein automated matches [190057] (21 species)
    not a true protein
  7. 1819474Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (2 PDB entries)
  8. 1819476Domain d4hpgb_: 4hpg B: [229227]
    automated match to d3em5a_
    complexed with nag, peg

Details for d4hpgb_

PDB Entry: 4hpg (more details), 2.54 Å

PDB Description: crystal structure of a glycosylated beta-1,3-glucanase (hev b 2), an allergen from hevea brasiliensis
PDB Compounds: (B:) Beta-1,3-glucanase

SCOPe Domain Sequences for d4hpgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpgb_ c.1.8.3 (B:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs

SCOPe Domain Coordinates for d4hpgb_:

Click to download the PDB-style file with coordinates for d4hpgb_.
(The format of our PDB-style files is described here.)

Timeline for d4hpgb_: