| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
| Protein automated matches [190057] (27 species) not a true protein |
| Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [189057] (4 PDB entries) |
| Domain d4hpgd_: 4hpg D: [229224] automated match to d3em5a_ complexed with nag, peg |
PDB Entry: 4hpg (more details), 2.54 Å
SCOPe Domain Sequences for d4hpgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hpgd_ c.1.8.3 (D:) automated matches {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}
evgvcygmqgnnlppvsevialykksnitrmriydpnqavlealrgsnielilgvpnsdl
qsltnpsnakswvqknvrgfwssvrfryiavgneispvnrgtawlaqfvlpamrnihdai
rsaglqdqikvstaidltlvgnsyppsagafrddvrsylnpiirflssirspllaniypy
ftyagnprdislpyalftspsvvvwdgqrgyknlfdatldalysalerasggslevvvse
sgwpsagafaatfdngrtylsnliqhvkrgtpkrpkraietylfamfdenkkqpevekhf
glffpnkwqkynlnfs
Timeline for d4hpgd_: