Lineage for d1rkrd_ (1rkr D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114453Protein Azurin [49530] (6 species)
  7. 1114473Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (4 PDB entries)
  8. 1114480Domain d1rkrd_: 1rkr D: [22922]
    complexed with cu

Details for d1rkrd_

PDB Entry: 1rkr (more details), 2.45 Å

PDB Description: crystal structure of azurin-i from alcaligenes xylosoxidans ncimb 11015
PDB Compounds: (D:) azurin-I

SCOPe Domain Sequences for d1rkrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkrd_ b.6.1.1 (D:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]}
aecsvdiagndgmqfdkkeitvsksckqftvnlkhpgklaknvmghnwvltkqadmqgav
ndgmaagldnnyvkkddarviahtkvigggetdsvtfdvsklaagedyayfcsfpghfal
mkgvlklvd

SCOPe Domain Coordinates for d1rkrd_:

Click to download the PDB-style file with coordinates for d1rkrd_.
(The format of our PDB-style files is described here.)

Timeline for d1rkrd_: