Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries) |
Domain d4bksg_: 4bks G: [229187] Other proteins in same PDB: d4bksb_, d4bksc_, d4bkse_, d4bksf_, d4bksh_, d4bksi_, d4bksk1, d4bksk2, d4bksl_ automated match to d4awjg_ complexed with act, x6c |
PDB Entry: 4bks (more details), 2.2 Å
SCOPe Domain Sequences for d4bksg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bksg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4bksg_: