Lineage for d4bksg_ (4bks G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931249Domain d4bksg_: 4bks G: [229187]
    Other proteins in same PDB: d4bksb_, d4bksc_, d4bkse_, d4bksf_, d4bksh_, d4bksi_, d4bksk1, d4bksk2, d4bksl_
    automated match to d4awjg_
    complexed with act, x6c

Details for d4bksg_

PDB Entry: 4bks (more details), 2.2 Å

PDB Description: von Hippel Lindau protein:ElonginB:ElonginC complex, in complex with (2S,4R)-1-ethanoyl-N-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4bksg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bksg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4bksg_:

Click to download the PDB-style file with coordinates for d4bksg_.
(The format of our PDB-style files is described here.)

Timeline for d4bksg_: