Lineage for d4bksf_ (4bks F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526324Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 1526325Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1526326Protein VHL [49470] (1 species)
  7. 1526327Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries)
  8. 1526339Domain d4bksf_: 4bks F: [229186]
    Other proteins in same PDB: d4bksa_, d4bksb_, d4bksd_, d4bkse_, d4bksg_, d4bksh_, d4bksj_, d4bksk_
    automated match to d1lqbc_
    complexed with act, x6c

Details for d4bksf_

PDB Entry: 4bks (more details), 2.2 Å

PDB Description: von Hippel Lindau protein:ElonginB:ElonginC complex, in complex with (2S,4R)-1-ethanoyl-N-[[4-(1,3-oxazol-5-yl)phenyl]methyl]-4-oxidanyl-pyrrolidine-2-carboxamide
PDB Compounds: (F:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4bksf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bksf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d4bksf_:

Click to download the PDB-style file with coordinates for d4bksf_.
(The format of our PDB-style files is described here.)

Timeline for d4bksf_: