Lineage for d1dz0a_ (1dz0 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Azurin [49530] (6 species) 
Species Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId:85698] [49532] (3 PDB entries) 
Domain d1dz0a_: 1dz0 A: [22918]
Details for d1dz0a_
PDB Entry: 1dz0 (more details), 1.75 Å
PDB Description: reduced azurin ii from alcaligenes xylosoxidans
SCOP Domain Sequences for d1dz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dz0a_ b.6.1.1 (A:) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms}
aqceatvesndamqynvkeivvdksckqftmhlkhvgkmakvamghnlvltkdadkqava
tdgmgaglaqdyvkagdtrviahtkvigggesdsvtfdvskiaagenyayfcsfpghwam
mkgtlklgs
SCOP Domain Coordinates for d1dz0a_:
Click to download the PDB-style file with coordinates for d1dz0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dz0a_:
- d1dz0a_ first appeared (with stable ids) in SCOP 1.55
- d1dz0a_ appears in SCOP 1.59
- d1dz0a_ appears in SCOP 1.63
- d1dz0a_ appears in the current release, SCOPe 2.08
View in 3D