Lineage for d3vu3a2 (3vu3 A:598-753)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840330Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1840628Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 1840629Protein Catalase, C-terminal domain [52329] (2 species)
  7. 1840630Species Escherichia coli, HPII [TaxId:562] [52330] (16 PDB entries)
  8. 1840691Domain d3vu3a2: 3vu3 A:598-753 [229174]
    Other proteins in same PDB: d3vu3a1, d3vu3c_, d3vu3d_, d3vu3e_, d3vu3f_, d3vu3g_, d3vu3h_
    automated match to d1ggea1
    protein/RNA complex; complexed with hem

Details for d3vu3a2

PDB Entry: 3vu3 (more details), 2.85 Å

PDB Description: Crystal structure of the Hfq and catalase HPII complex
PDB Compounds: (A:) catalase hpii

SCOPe Domain Sequences for d3vu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vu3a2 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3vu3a2:

Click to download the PDB-style file with coordinates for d3vu3a2.
(The format of our PDB-style files is described here.)

Timeline for d3vu3a2: