SCOPe 2.08: Domain d3vu3a2: 3vu3 A:598-753

Lineage for d3vu3a2 (3vu3 A:598-753)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (2 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries)

8. Domain d3vu3a2: 3vu3 A:598-753 [229174]
   Other proteins in same PDB: d3vu3a1, d3vu3c_, d3vu3d_, d3vu3e_, d3vu3f_, d3vu3g_, d3vu3h_
   automated match to d1ggea1
   protein/RNA complex; complexed with hem

Details for d3vu3a2

PDB Entry: 3vu3, 2.85 Å

PDB Description: Crystal structure of the Hfq and catalase HPII complex

PDB Compounds: (A:) catalase hpii

SCOPe Domain Sequences for d3vu3a2:

Sequence; same for both SEQRES and ATOM records:

>d3vu3a2 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d3vu3a2:

• d3vu3a2 first appeared in SCOPe 2.03
  
• d3vu3a2 appears in SCOPe 2.07