Lineage for d1a4aa_ (1a4a A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. Protein Azurin [49530] (6 species)
  7. Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. Domain d1a4aa_: 1a4a A: [22907]
    complexed with cu; mutant

Details for d1a4aa_

PDB Entry: 1a4a (more details), 1.8900000000000001 Å

PDB Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d1a4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4aa_ b.6.1.1 (A:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn

SCOPe Domain Coordinates for d1a4aa_ are not available.

Timeline for d1a4aa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a4ab_