PDB entry 1a4a

View 1a4a on RCSB PDB site
Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Class: electron transport
Keywords: electron transport, cuproprotein
Deposited on 1998-01-28, released 1998-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.07: d1a4aa_
  • Chain 'B':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (15)
      • see remark 999 (41)
      • conflict (56)
      • engineered (120)
    Domains in SCOPe 2.07: d1a4ab_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4aA (A:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1a4aB (B:)
    aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    hkgtlklsn