PDB entry 1a4a
View 1a4a on RCSB PDB site
Description: azurin mutant with met 121 replaced by his, ph 6.5 crystal form, data collected at 16 degrees celsius
Class: electron transport
Keywords: electron transport, cuproprotein
Deposited on
1998-01-28, released
1998-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-04-28, with a file datestamp of
2021-04-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Azurin
Species: Achromobacter denitrificans [TaxId:32002]
Gene: AZU
Database cross-references and differences (RAF-indexed):
- Uniprot P00280 (0-128)
- conflict (15)
- see remark 999 (41)
- conflict (56)
- engineered mutation (120)
Domains in SCOPe 2.08: d1a4aa_ - Chain 'B':
Compound: Azurin
Species: Achromobacter denitrificans [TaxId:32002]
Gene: AZU
Database cross-references and differences (RAF-indexed):
- Uniprot P00280 (0-128)
- conflict (15)
- see remark 999 (41)
- conflict (56)
- engineered mutation (120)
Domains in SCOPe 2.08: d1a4ab_ - Heterogens: CU, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1a4aA (A:)
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1a4aB (B:)
aqceatiesndamqydlkemvvdksckqftvhlkhvgkmaksamghnwvltkeadkegva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
hkgtlklsn