Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Brucella suis [TaxId:470137] [229017] (3 PDB entries) |
Domain d4ni5a_: 4ni5 A: [229019] automated match to d1fmca_ complexed with mg |
PDB Entry: 4ni5 (more details), 1.7 Å
SCOPe Domain Sequences for d4ni5a_:
Sequence, based on SEQRES records: (download)
>d4ni5a_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]} mrfkdkvvivtggasgigeatarafiregakvviadfsdhgqqladeragaheqalfikt dvadtravqaliartvenygrldimfanagiaadapideldeaawqktidinltgvylcd kyaidqmrsqgggvivncgsihshvgksgvtayaaakggvklltqtlaidygpqnirvna vcpgyidtpllknipddkkqalvalhpmgrlgraeevanavlflasdeasfvngasllvd ggytaq
>d4ni5a_ c.2.1.0 (A:) automated matches {Brucella suis [TaxId: 470137]} mrfkdkvvivtggasgigeatarafiregakvviadfsdalfiktdvadtravqaliart venygrldimfanagiaadapideldeaawqktidinltgvylcdkyaidqmrsqgggvi vncgsihshvgksgvtayaaakggvklltqtlaidygpqnirvnavcpgyidtpddkkqa lvalhpmgrlgraeevanavlflasdeasfvngasllvdggytaq
Timeline for d4ni5a_: