Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins) automatically mapped to Pfam PF00756 |
Protein automated matches [227016] (2 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [225761] (5 PDB entries) |
Domain d4mqla_: 4mql A: [228988] automated match to d1sfra_ complexed with btb; mutant |
PDB Entry: 4mql (more details), 1.3 Å
SCOPe Domain Sequences for d4mqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mqla_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} fsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyy qsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaa vglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwgp ssdpawkrndpmvqiprlvanntriwvysgngtpsdlggdnipakflegltlrtnqtfrd tyaadggrngvfnfppngthswpywneqlvamkadiqhvlng
Timeline for d4mqla_: