Lineage for d4n96a2 (4n96 A:123-244)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1669826Family d.131.1.1: DNA polymerase III, beta subunit [55980] (1 protein)
    duplication: consists of three domains of this fold
  6. 1669827Protein DNA polymerase III, beta subunit [55981] (2 species)
  7. 1669828Species Escherichia coli [TaxId:562] [55982] (30 PDB entries)
    Uniprot P00583
  8. 1669908Domain d4n96a2: 4n96 A:123-244 [228864]
    automated match to d3d1ga2
    complexed with 6ni, ca, cl, peg

Details for d4n96a2

PDB Entry: 4n96 (more details), 1.7 Å

PDB Description: E. coli sliding clamp in complex with 6-nitroindazole
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4n96a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n96a2 d.131.1.1 (A:123-244) DNA polymerase III, beta subunit {Escherichia coli [TaxId: 562]}
qseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavcsm
pigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgrfp
dy

SCOPe Domain Coordinates for d4n96a2:

Click to download the PDB-style file with coordinates for d4n96a2.
(The format of our PDB-style files is described here.)

Timeline for d4n96a2: