Lineage for d1paz__ (1paz -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Pseudoazurin [49522] (4 species) 
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (10 PDB entries) 
Domain d1paz__: 1paz - [22878]
Details for d1paz__
PDB Entry: 1paz (more details), 1.55 Å
PDB Description: refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
SCOP Domain Sequences for d1paz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1paz__ b.6.1.1 (-) Pseudoazurin {Alcaligenes faecalis, strain s-6}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
SCOP Domain Coordinates for d1paz__:
Click to download the PDB-style file with coordinates for d1paz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1paz__:
- d1paz__ first appeared (with stable ids) in SCOP 1.55
- d1paz__ appears in SCOP 1.57
- d1paz__ appears in SCOP 1.61
- d1paz__ appears in the current release, SCOPe 2.08, called d1paza_
View in 3D