SCOPe 2.03: Domain d4n68a_: 4n68 A:

Lineage for d4n68a_ (4n68 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (10 PDB entries)

8. Domain d4n68a_: 4n68 A: [228723]
   automated match to d1va9a1
   complexed with so4

Details for d4n68a_

PDB Entry: 4n68, 1.8 Å

PDB Description: crystal structure of an internal fn3 domain from human contactin-5 [psi-nysgrc-005804]

PDB Compounds: (A:) Contactin-5

SCOPe Domain Sequences for d4n68a_:

Sequence; same for both SEQRES and ATOM records:

>d4n68a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epsaaptdvkatsvsvseilvawkhikeslgrpqgfevgywkdmeqedtaetvktrgnes
fviltglegntlyhftvrayngagygppssevsattkka

Timeline for d4n68a_:

• d4n68a_ is new in SCOPe 2.03-stable
  
• d4n68a_ appears in SCOPe 2.04
  
• d4n68a_ appears in the current release, SCOPe 2.08, called d4n68a1