SCOPe 2.08: Domain d4n68a1: 4n68 A:874-971

Lineage for d4n68a1 (4n68 A:874-971)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d4n68a1: 4n68 A:874-971 [228723]
   Other proteins in same PDB: d4n68a2
   automated match to d1va9a1
   complexed with so4

Details for d4n68a1

PDB Entry: 4n68, 1.8 Å

PDB Description: crystal structure of an internal fn3 domain from human contactin-5 [psi-nysgrc-005804]

PDB Compounds: (A:) Contactin-5

SCOPe Domain Sequences for d4n68a1:

Sequence; same for both SEQRES and ATOM records:

>d4n68a1 b.1.2.0 (A:874-971) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epsaaptdvkatsvsvseilvawkhikeslgrpqgfevgywkdmeqedtaetvktrgnes
fviltglegntlyhftvrayngagygppssevsattkk

Timeline for d4n68a1:

• d4n68a1 first appeared in SCOPe 2.03, called d4n68a_
  
• d4n68a1 appears in SCOPe 2.07