SCOPe 2.04: Domain d4mlua1: 4mlu A:373-500

Lineage for d4mlua1 (4mlu A:373-500)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (18 PDB entries)

8. Domain d4mlua1: 4mlu A:373-500 [228718]
   automated match to d3bzia1

Details for d4mlua1

PDB Entry: 4mlu, 1.45 Å

PDB Description: Peptides Containing Mono-anionic Phosphothreonine Esters That Exhibit High Plk1 Polo-box Domain-binding Affinities and Potent Antiproliferative Effects in HeLa Cells

PDB Compounds: (A:) Serine/threonine-protein kinase PLK1

SCOPe Domain Sequences for d4mlua1:

Sequence; same for both SEQRES and ATOM records:

>d4mlua1 d.223.1.2 (A:373-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdnsv
gvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehllk
aganitpr

Timeline for d4mlua1:

• d4mlua1 first appeared in SCOPe 2.03
  
• d4mlua1 does not appear in SCOPe 2.05