Lineage for d4lk6c_ (4lk6 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384329Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2384330Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2384331Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries)
  8. 2384449Domain d4lk6c_: 4lk6 C: [228681]
    automated match to d1l7la_
    complexed with ca, gal, lrd

Details for d4lk6c_

PDB Entry: 4lk6 (more details), 2.86 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin leca complexed with chlorophenol red-b-d-galactopyranoside at 2.86 a resolution
PDB Compounds: (C:) PA-I galactophilic lectin

SCOPe Domain Sequences for d4lk6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lk6c_ b.18.1.16 (C:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

SCOPe Domain Coordinates for d4lk6c_:

Click to download the PDB-style file with coordinates for d4lk6c_.
(The format of our PDB-style files is described here.)

Timeline for d4lk6c_: