SCOPe 2.04: Domain d4kp0a_: 4kp0 A:

Lineage for d4kp0a_ (4kp0 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187421] (42 PDB entries)

8. Domain d4kp0a_: 4kp0 A: [228663]
   automated match to d4i8ha_
   complexed with kpk

Details for d4kp0a_

PDB Entry: 4kp0, 2.8 Å

PDB Description: Crystal Structure of the human Chymase with TJK002

PDB Compounds: (A:) Chymase

SCOPe Domain Sequences for d4kp0a_:

Sequence, based on SEQRES records:

>d4kp0a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfpsqfnfvppg
rmcrvagwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkg
dsggpllcagvaqgivsygrsdakppavftrishyrpwinqilqan

Sequence, based on observed residues (ATOM records):

>d4kp0a_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggteckphsrpymayleivtsngpskfcggflirrnfvltaahcagrsitvtlgahni
teeedtwqklevikqfrhpkyntstlhhdimllklkekasltlavgtlpfvppgrmcrva
gwgrtgvlkpgsdtlqevklrlmdpqacshfrdfdhnlqlcvgnprktksafkgdsggpl
lcagvaqgivsygrsdakppavftrishyrpwinqilqan

Timeline for d4kp0a_:

• d4kp0a_ first appeared in SCOPe 2.03
  
• d4kp0a_ appears in SCOPe 2.05
  
• d4kp0a_ appears in the current release, SCOPe 2.08