Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase SYK [118131] (1 species) PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [118132] (52 PDB entries) Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576) |
Domain d4i0ra_: 4i0r A: [228655] automated match to d1xbba_ complexed with 1b4 |
PDB Entry: 4i0r (more details), 2.1 Å
SCOPe Domain Sequences for d4i0ra_:
Sequence, based on SEQRES records: (download)
>d4i0ra_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy dlmnlcwtydvenrpgfaavelrlrnyyydvvneghh
>d4i0ra_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} vyldrklltledelgsgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqqldnpy ivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnfv hrdlaarnvllvtqhyakisdfglskalradenyykakwpvkwyapecinyykfssksdv wsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydven rpgfaavelrlrnyyydvvneghh
Timeline for d4i0ra_: