Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (67 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [228629] (5 PDB entries) |
Domain d4hncb1: 4hnc B:3-132 [228630] Other proteins in same PDB: d4hnca2, d4hncb2 automated match to d2mnra2 complexed with 0ut, mg |
PDB Entry: 4hnc (more details), 1.89 Å
SCOPe Domain Sequences for d4hncb1:
Sequence, based on SEQRES records: (download)
>d4hncb1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl kqllddmaamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetp lvkllganar
>d4hncb1 d.54.1.0 (B:3-132) automated matches {Pseudomonas putida [TaxId: 303]} evlitglrtravnvplaypvhgtaplvlidlatsagvvghsylfaytpvalkslkqlldd maamivneplapvsleamlakrfslagytglirmaaagidmaawdalgkvhetplvkllg anar
Timeline for d4hncb1: