Lineage for d2plta_ (2plt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770828Protein Plastocyanin [49507] (17 species)
  7. 2770843Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49514] (1 PDB entry)
  8. 2770844Domain d2plta_: 2plt A: [22862]
    complexed with ca, cu

Details for d2plta_

PDB Entry: 2plt (more details), 1.5 Å

PDB Description: structure determination of plastocyanin from a crystal specimen with hemihedral twinning fraction of one-half
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2plta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
datvklgadsgalefvpktltiksgetvnfvnnagfphnivfdedaipsgvnadaisrdd
ylnapgetysvkltaageygyycephqgagmvgkiivq

SCOPe Domain Coordinates for d2plta_:

Click to download the PDB-style file with coordinates for d2plta_.
(The format of our PDB-style files is described here.)

Timeline for d2plta_: