Lineage for d2plt__ (2plt -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11068Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49514] (1 PDB entry)
  8. 11069Domain d2plt__: 2plt - [22862]

Details for d2plt__

PDB Entry: 2plt (more details), 1.5 Å

PDB Description: structure determination of plastocyanin from a crystal specimen with hemihedral twinning fraction of one-half

SCOP Domain Sequences for d2plt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plt__ b.6.1.1 (-) Plastocyanin {Green alga (Chlamydomonas reinhardtii)}
datvklgadsgalefvpktltiksgetvnfvnnagfphnivfdedaipsgvnadaisrdd
ylnapgetysvkltaageygyycephqgagmvgkiivq

SCOP Domain Coordinates for d2plt__:

Click to download the PDB-style file with coordinates for d2plt__.
(The format of our PDB-style files is described here.)

Timeline for d2plt__: