Lineage for d4hm2b_ (4hm2 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543693Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2543705Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 2543727Species Pseudomonas sp. [TaxId:69011] [228596] (10 PDB entries)
  8. 2543735Domain d4hm2b_: 4hm2 B: [228607]
    Other proteins in same PDB: d4hm2a1, d4hm2a2
    automated match to d1o7nb_
    complexed with 16m, edo, fe, fes, so4

Details for d4hm2b_

PDB Entry: 4hm2 (more details), 1.6 Å

PDB Description: naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase subunit beta

SCOPe Domain Sequences for d4hm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm2b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 69011]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d4hm2b_:

Click to download the PDB-style file with coordinates for d4hm2b_.
(The format of our PDB-style files is described here.)

Timeline for d4hm2b_: