SCOPe 2.03: Domain d4hcda2: 4hcd A:127-382

Lineage for d4hcda2 (4hcd A:127-382)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)

6. Protein automated matches [226997] (6 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226506] (4 PDB entries)

8. Domain d4hcda2: 4hcd A:127-382 [228590]
   Other proteins in same PDB: d4hcda1
   automated match to d4hcha2
   complexed with cl, mg, na

Details for d4hcda2

PDB Entry: 4hcd, 1.7 Å

PDB Description: Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium

PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcda2:

Sequence; same for both SEQRES and ATOM records:

>d4hcda2 c.1.11.2 (A:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrvr

Timeline for d4hcda2:

• d4hcda2 is new in SCOPe 2.03-stable
  
• d4hcda2 appears in SCOPe 2.04
  
• d4hcda2 appears in the current release, SCOPe 2.08