Lineage for d4hcda2 (4hcd A:127-382)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837131Species Agrobacterium tumefaciens [TaxId:176299] [226506] (6 PDB entries)
  8. 2837142Domain d4hcda2: 4hcd A:127-382 [228590]
    Other proteins in same PDB: d4hcda1, d4hcda3
    automated match to d4hcha2
    complexed with cl, mg, na

Details for d4hcda2

PDB Entry: 4hcd (more details), 1.7 Å

PDB Description: Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcda2 c.1.11.2 (A:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd
lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl
sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec
evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg
lgedidftfidnnrvr

SCOPe Domain Coordinates for d4hcda2:

Click to download the PDB-style file with coordinates for d4hcda2.
(The format of our PDB-style files is described here.)

Timeline for d4hcda2: