Lineage for d1plba_ (1plb A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660500Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 660737Protein Plastocyanin [49507] (14 species)
  7. 660769Species Parsley (Petroselinum crispum) [TaxId:4043] [49510] (2 PDB entries)
  8. 660770Domain d1plba_: 1plb A: [22856]
    complexed with cu

Details for d1plba_

PDB Entry: 1plb (more details)

PDB Description: high-resolution solution structure of reduced parsley plastocyanin
PDB Compounds: (A:) plastocyanin

SCOP Domain Sequences for d1plba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plba_ b.6.1.1 (A:) Plastocyanin {Parsley (Petroselinum crispum) [TaxId: 4043]}
aevklgsddgglvfspssftvaagekitfknnagfphnivfdedevpagvnaekisqpey
lngagetyevtltekgtykfycephagagmkgevtvn

SCOP Domain Coordinates for d1plba_:

Click to download the PDB-style file with coordinates for d1plba_.
(The format of our PDB-style files is described here.)

Timeline for d1plba_: